PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G14660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 307aa    MW: 33672.5 Da    PI: 6.5738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G14660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.7e-093176144
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     rg+WT+eE + + +a +    +   +W+++a++++ g+t  ++  ++
  LPERR05G14660.1 31 RGAWTPEENKAFEQALAAVDRNdpeRWERVAEMLP-GKTVADVMTHY 76
                     89*************9999988999**********.********999 PP

2Myb_DNA-binding45.71.5e-14148192347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
  LPERR05G14660.1 148 PWTEEEHKLFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 192
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-53078IPR009057Homeodomain-like
PROSITE profilePS500907.0393080IPR017877Myb-like domain
SMARTSM007172.1E-93082IPR001005SANT/Myb domain
PfamPF002491.1E-73176IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-103287IPR009057Homeodomain-like
CDDcd001671.40E-73376No hitNo description
PROSITE profilePS5129417.568141197IPR017930Myb domain
SuperFamilySSF466891.36E-17143197IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-17144195IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-12145191IPR009057Homeodomain-like
SMARTSM007175.8E-13145195IPR001005SANT/Myb domain
PfamPF002497.1E-12148192IPR001005SANT/Myb domain
CDDcd001671.95E-11148193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MESYMEVLPP APAHYFVGQP SAGGWFLQDR RGAWTPEENK AFEQALAAVD RNDPERWERV  60
AEMLPGKTVA DVMTHYDDLE NDVCFIEAGL VPFPQYGAGA GSPSSGFTFD WDGADDAAGL  120
AFKRSCYIVG GGKRGARGPD QERKKGVPWT EEEHKLFLMG LKKYGRGDWR NISRNFVTSR  180
TPTQVASHAQ KYFIRLNSGG KDKRRSSIHD ITTVNLPDED HGNNPSPSPP SVLTAAHSSS  240
SSAAVSDQFG VLVDSKPPPP TTLGHHHFMP HHPYAQVKLE ASNSHVGGRF DDSVLMQMQC  300
GQLQPLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-15341021179RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0681380.0AK068138.1 Oryza sativa Japonica Group cDNA clone:J013135D01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654489.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-83DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D9WH620.0A0A0D9WH62_9ORYZ; Uncharacterized protein
STRINGOB05G26340.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-78MYB family protein